Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

3,391 – 3,405 of 115,739 results

3,391

R&D Systems™ Recombinant Human CEACAM-5/CD66e Fc Chimera Protein

HEK293 Expressed Protein

Pricing & Availability

3,392

R&D Systems™ Recombinant Human B7-H6 His-tag Avi-tag Protein

Biotinylated

Pricing & Availability

3,393

R&D Systems™ Recombinant Human Carboxylesterase 2/CES2 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Enzyme Activity

Pricing & Availability

3,394

R&D Systems™ Recombinant HCoV-OC43 Nucleocapsid His-tag Protein

Pricing & Availability

3,395

R&D Systems™ Recombinant Human IL-6 Protein

A New rh IL-6 is Available! The new protein has ∼2 fold better activity and is HEK293 expressed!

Pricing & Availability
Specifications

Purity or Quality Grade	>97%, by SDS-PAGE under reducing conditions and visualized by silver stain.
Conjugate	Unconjugated
Molecular Weight (g/mol)	M.W. theroretical: 20.9 kDa
Gene Symbol	IL6
Endotoxin Concentration	<0.10 EU / 1 μg of the protein by the LAL method.
Storage Requirements	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20°C to -70°C as supplied. 1 month, 2°C to 8°C under sterile conditions after reconstitution. 3 months, -20°C to -70°C under sterile conditions after reconstitution.
For Use With (Application)	Bioactivity
Protein	IL-6
Source	E. coli-derived human IL-6 protein Pro29-Met212
Name	IL-6
Accession Number	Q75MH2
Gene Alias	B-cell differentiation factor, B-cell stimulatory factor 2, BSF2, BSF-2, CDF, CTL differentiation factor, HSF, hybridoma growth factor, IFNB2, IFN-beta-2, IL6, IL-6, Interferon beta-2, interleukin 6 (interferon, beta 2), interleukin BSF-2, interleukin-6, MGI-2A
Gene ID (Entrez)	3569
Formulation	Lyophilized from a 0.2 μm filtered solution in PBS and NaCl.
Recombinant	Recombinant

3,396

R&D Systems™ Recombinant Human IL-19 (NS0-expressed) Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

3,397

R&D Systems™ Recombinant Human Active SHP-2 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Enzyme Activity

Pricing & Availability

3,398

MilliporeSigma™ Hemocyanin, Keyhole Limpet, Megathura crenulata, BES/Mg2+ Buffer, Protein

Pricing & Availability

3,399

R&D Systems™ Recombinant Human XCL1/Lymphotactin Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability
Specifications

Purity or Quality Grade	97%, by SDS-PAGE under reducing conditions and visualized by silver stain.
Conjugate	Unconjugated
Molecular Weight (g/mol)	10.4 kDa
Gene ID (Entrez)	6375
Quantity	25 μg
Storage Requirements	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution.
Source	E. coli-derived human XCL1/Lymphotactin protein Val22-Gly114,with an N-terminal Met
Recombinant	Recombinant
Name	XCL1/Lymphotactin

3,400

R&D Systems™ Recombinant Mouse TNF RI/TNFRSF1A Fc Chimera Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability
Specifications

Purity or Quality Grade	>90%, by SDS-PAGE under reducing conditions and visualized by silver stain.
Conjugate	Unconjugated
Molecular Weight (g/mol)	48.6 kDa (monomer)
Gene ID (Entrez)	21937
Quantity	50 μg
Structural Form	Disulfide-linked homodimer
Storage Requirements	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution.
Source	Mouse myeloma cell line,NS0-derived mouse TNF RI/TNFRSF1A protein, (N-terminus) Mouse TNF RI (Leu30-Ala212) Accession &Num; P25118 DIEGRMD Human IgG1 (Pro100-Lys330) 6-His tag (C-terminus)
Recombinant	Recombinant
Name	TNF RI/TNFRSF1A Fc Chimera

3,401

R&D Systems™ Recombinant Human Lipoprotein Lipase/LPL Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

3,402

R&D Systems™ Recombinant Mouse AMIGO3 Fc Chimera Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

3,403

Novus Biologicals™ PGAM1 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	Protein
Purity or Quality Grade	>90%
Conjugate	Unconjugated
Common Name	PGAM1
Molecular Weight (g/mol)	30.9kDa
Formulation	Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol 1mM DTT.
Immunogen	PGAM1, 1-254 aa. Sequence: MGSSHHHHHHSSGLVPRGSHMAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	1mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Human

3,404

R&D Systems™ Recombinant Porcine IL-5 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability
Specifications

Purity or Quality Grade	95%, by SDS-PAGE under reducing conditions and visualized by silver stain.
Conjugate	Unconjugated
Molecular Weight (g/mol)	14 kDa (monomer)
Gene ID (Entrez)	397409
Quantity	10 μg
Structural Form	Disulfide-linked homodimer
Storage Requirements	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution.
Source	Mouse myeloma cell line,NS0-derived porcine IL-5 protein Ile20-Ser134,with a C-terminal 6-His tag
Recombinant	Recombinant
Name	IL-5

3,405

R&D Systems™ Recombinant Cynomolgus/Rhesus Macaque BTLA Fc Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability

Prev
1
...
225
226
227
228
...
7,716
Next

Welcome to fishersci.com

Recombinant Proteins

Filtered Search Results

Narrow Results

R&D Systems™ Recombinant Human IL-6 Protein GSA/VA ContractAvailable on GSA/VA contract for Federal Government customers.Learn More

Novus Biologicals™ PGAM1 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

R&D Systems™ Recombinant Human IL-6 Protein

Novus Biologicals™ PGAM1 Protein